SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|215277000|ref|NP_001135840.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215277000|ref|NP_001135840.1|
Domain Number 1 Region: 86-189
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.81e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|215277000|ref|NP_001135840.1|
Sequence length 191
Comment glutathione S-transferase Mu 2 isoform 2 [Homo sapiens]
Sequence
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEHS
Download sequence
Identical sequences ENSP00000416883 ENSP00000435910 NP_001135840.1.87134 NP_001135840.1.92137 gi|215277000|ref|NP_001135840.1| ENSP00000416883 ENSP00000435910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]