SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21536386|ref|NP_068368.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21536386|ref|NP_068368.2|
Domain Number 1 Region: 238-438
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.1e-46
Family Reprolysin-like 0.00024
Further Details:      
 
Domain Number 2 Region: 453-529
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.32e-19
Family Blood coagulation inhibitor (disintegrin) 0.00035
Further Details:      
 
Weak hits

Sequence:  gi|21536386|ref|NP_068368.2|
Domain Number - Region: 677-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Integrin beta EGF-like domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21536386|ref|NP_068368.2|
Sequence length 899
Comment disintegrin and metalloproteinase domain-containing protein 22 isoform 2 preproprotein [Homo sapiens]
Sequence
MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSG
GEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHI
EHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQE
DFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKY
IELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFA
ISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEF
GKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIE
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLT
QDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQG
ICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
GYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQ
MMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDD
AKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRSNGLSHSWSERIP
DTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTEYLNPWFKRDYNVAKWVE
DVNKNTEGPYFRTLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
Download sequence
Identical sequences ENSP00000381267 NP_068368.2.87134 NP_068368.2.92137 gi|21536386|ref|NP_068368.2| ENSP00000381267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]