SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21687228|ref|NP_660274.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21687228|ref|NP_660274.1|
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily EF-hand 1.06e-27
Family Calmodulin-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21687228|ref|NP_660274.1|
Sequence length 163
Comment EF-hand calcium-binding domain-containing protein 11 [Homo sapiens]
Sequence
MFFSEARARSRTWEASPSEHRKWVEVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEV
DSVMSSINPNTSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAF
RQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYALNYGQKEA
Download sequence
Identical sequences H2Q8R9 Q9BUY7
ENSPTRP00000011268 GO.38058 NP_660274.1.87134 NP_660274.1.92137 XP_008956423.1.60992 XP_009426557.1.37143 gi|21687228|ref|NP_660274.1| 9598.ENSPTRP00000011266 9606.ENSP00000326267 ENSP00000326267 ENSP00000267544 ENSP00000326267 ENSPTRP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]