SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21704277|ref|NP_002217.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21704277|ref|NP_002217.3|
Domain Number 1 Region: 449-578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 2 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000218
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 738-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 4 Region: 636-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 349-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000336
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 671-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000125
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 307-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 715-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|21704277|ref|NP_002217.3|
Domain Number - Region: 601-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 425-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0607
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21704277|ref|NP_002217.3|
Sequence length 1238
Comment protein jagged-2 isoform a precursor [Homo sapiens]
Sequence
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE
Download sequence
Identical sequences Q9Y219
gi|21704277|ref|NP_002217.3| ENSP00000328169 ENSP00000328169 9606.ENSP00000328169 ENSP00000328169 NP_002217.3.87134 NP_002217.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]