SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21704279|ref|NP_660142.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21704279|ref|NP_660142.1|
Domain Number 1 Region: 410-540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 2 Region: 700-826
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000259
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 598-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000733
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 382-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.008
Further Details:      
 
Domain Number 5 Region: 349-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 633-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 307-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000172
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 677-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|21704279|ref|NP_660142.1|
Domain Number - Region: 563-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000324
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21704279|ref|NP_660142.1|
Sequence length 1200
Comment protein jagged-2 isoform b precursor [Homo sapiens]
Sequence
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLAD
GFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPC
PGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENID
DCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYC
ACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPN
PCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPG
FAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTP
FPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQC
LRPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSL
PATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGN
SSLLLAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRL
PREESANNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDE
EDEDLGRGEEDSLEAEKFLSHKFTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE
Download sequence
Identical sequences NP_660142.1.87134 NP_660142.1.92137 gi|21704279|ref|NP_660142.1| ENSP00000328566 ENSP00000328566 NYSGRC-21704279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]