SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21735584|ref|NP_663162.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21735584|ref|NP_663162.1|
Domain Number 1 Region: 455-818
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.28e-126
Family Oxysterol-binding protein 0.00087
Further Details:      
 
Domain Number 2 Region: 17-144
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-19
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21735584|ref|NP_663162.1|
Sequence length 820
Comment oxysterol-binding protein-related protein 3 isoform d [Homo sapiens]
Sequence
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTE
EHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSIS
SRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLL
QSMDVLHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSK
MQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSENSRD
ENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNL
SNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPV
ELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNP
VLGETYECIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPI
GTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKVNFIKAKY
WSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVWRANPMPKGYEQYYSFTQ
FALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENH
VEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW
Download sequence
Identical sequences K7DTQ5
NP_663162.1.87134 NP_663162.1.92137 XP_003807974.1.60992 XP_006715746.1.92137 ENSP00000386953 ENSP00000389779 gi|21735584|ref|NP_663162.1| ENSP00000386953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]