SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218563749|ref|NP_085152.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218563749|ref|NP_085152.2|
Domain Number 1 Region: 2-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-86
Family BAR domain 0.00047
Further Details:      
 
Domain Number 2 Region: 404-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.71e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.0002
Further Details:      
 
Domain Number 3 Region: 263-367
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-27
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 4 Region: 673-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-24
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218563749|ref|NP_085152.2|
Sequence length 834
Comment arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 [Homo sapiens]
Sequence
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVN
QIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLR
PHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDTEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES
Download sequence
Identical sequences Q96P50
ENSP00000321139 ENSP00000346733 9606.ENSP00000346733 ENSP00000346733 NP_085152.2.87134 NP_085152.2.92137 gi|218563749|ref|NP_085152.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]