SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218751877|ref|NP_001136329.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218751877|ref|NP_001136329.1|
Domain Number 1 Region: 12-143
Classification Level Classification E-value
Superfamily EF-hand 8.1e-32
Family Calmodulin-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218751877|ref|NP_001136329.1|
Sequence length 159
Comment EF-hand calcium-binding domain-containing protein 1 isoform b [Homo sapiens]
Sequence
MNRKKLQKLTDTLTKNCKHLFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVF
DLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYEL
AVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
Download sequence
Identical sequences A0A024R7U7 A0A2J8UMY8
ENSP00000400873 ENSP00000430765 ENSP00000400873 ENSP00000430765 gi|218751877|ref|NP_001136329.1| NP_001136329.1.87134 NP_001136329.1.92137 XP_009242061.1.23681 XP_009242062.1.23681 XP_016869315.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]