SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218931217|ref|NP_001136400.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218931217|ref|NP_001136400.1|
Domain Number 1 Region: 31-167
Classification Level Classification E-value
Superfamily L domain-like 2.65e-25
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218931217|ref|NP_001136400.1|
Sequence length 259
Comment leucine-rich repeat-containing protein 61 [Homo sapiens]
Sequence
MDPPAEKPGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDL
SGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAG
LPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLD
SSLRPSSSPGPRATEAQPWVEPGYWESWPSRSSSILEEACRQFQDTLQECWDLDRQASDS
LAQAEQVLSSAGPTSSFVF
Download sequence
Identical sequences A0A090N7W5 Q9BV99
9606.ENSP00000339047 NP_001136400.1.87134 NP_001136400.1.92137 NP_076431.1.87134 NP_076431.1.92137 XP_006716158.1.92137 gi|13027616|ref|NP_076431.1| gi|218931217|ref|NP_001136400.1| ENSP00000339047 ENSP00000352642 ENSP00000420560 ENSP00000339047 GO.37869 ENSP00000339047 ENSP00000352642 ENSP00000420560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]