SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219555700|ref|NP_001137229.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219555700|ref|NP_001137229.1|
Domain Number 1 Region: 49-156
Classification Level Classification E-value
Superfamily L domain-like 5.55e-21
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219555700|ref|NP_001137229.1|
Sequence length 530
Comment leucine-rich repeat-containing protein 27 isoform a [Homo sapiens]
Sequence
MEGSSSYEVPSVAAADLEEGAGQTRSLPATPSKDVHKGVGGIIFSSSPILDLSESGLCRL
EEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRYNRIKALPSGIGAHQHLKTLL
LERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRMWAVEHSLPRN
PTSQEAPPVREMTLRDLPSPGLELSGDHASNQGAVNAQDPEGAVMKEKASFLPPVEKPDL
SELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKAALNIEKE
LPKPRHVFRRKTASSRSILPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQRREK
RALQEWRERAQRMRKRKEELSKLLPPRRSMVASKIPSATDLIDNRKVPLNPPGKMKPSKE
KSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEV
LKLKLGLTLNKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGNVRRYQ
Download sequence
Identical sequences A0A140VJN2 Q9C0I9
gi|219555700|ref|NP_001137229.1| gi|55741567|ref|NP_085129.1| 9606.ENSP00000357602 ENSP00000357602 ENSP00000357603 NP_001137229.1.87134 NP_001137229.1.92137 NP_085129.1.87134 NP_085129.1.92137 XP_006718046.1.92137 XP_011538510.1.92137 ENSP00000357602 ENSP00000357603 ENSP00000348978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]