SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219555704|ref|NP_001137231.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219555704|ref|NP_001137231.1|
Domain Number 1 Region: 49-156
Classification Level Classification E-value
Superfamily L domain-like 4.25e-21
Family Ngr ectodomain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219555704|ref|NP_001137231.1|
Sequence length 383
Comment leucine-rich repeat-containing protein 27 isoform c [Homo sapiens]
Sequence
MEGSSSYEVPSVAAADLEEGAGQTRSLPATPSKDVHKGVGGIIFSSSPILDLSESGLCRL
EEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRYNRIKALPSGIGAHQHLKTLL
LERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRMWAVEHSLPRN
PTSQEAPPVREMTLRDLPSPGLELSGDHASNQGAVNAQDPEGAVMKEKASFLPPVEKPDL
SELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKAALNIEKE
LPKPRHVFRTRVPRKQALQRLHERKTRIMGVVGRAPTHMGEGRQPPPGASYPTSCHRTKW
RSEQKDWKRAERRRSESSRRSRL
Download sequence
Identical sequences gi|219555704|ref|NP_001137231.1| NP_001137231.1.87134 NP_001137231.1.92137 XP_016872181.1.92137 ENSP00000342641 ENSP00000376413 ENSP00000342641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]