SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219842317|ref|NP_001137151.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219842317|ref|NP_001137151.1|
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-19
Family DsbA-like 0.0000045
Further Details:      
 
Domain Number 2 Region: 183-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000142
Family DsbA-like 0.00000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219842317|ref|NP_001137151.1|
Sequence length 282
Comment glutathione S-transferase kappa 1 isoform b [Homo sapiens]
Sequence
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVF
SSSQNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLP
ITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Download sequence
Identical sequences ENSP00000431049 gi|219842317|ref|NP_001137151.1| NP_001137151.1.87134 NP_001137151.1.92137 ENSP00000431049 ENSP00000431049 9606.ENSP00000367415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]