SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219842325|ref|NP_001137298.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219842325|ref|NP_001137298.1|
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 200-260
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.57e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219842325|ref|NP_001137298.1|
Sequence length 284
Comment microtubule-associated protein RP/EB family member 2 isoform 2 [Homo sapiens]
Sequence
MAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKK
VKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYD
GKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSS
AKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHG
QENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
Download sequence
Identical sequences ENSP00000396074 ENSP00000464921 ENSP00000396074 ENSP00000464921 gi|219842325|ref|NP_001137298.1| NP_001137298.1.87134 NP_001137298.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]