SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219842335|ref|NP_001137153.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219842335|ref|NP_001137153.1|
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-32
Family DsbA-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219842335|ref|NP_001137153.1|
Sequence length 183
Comment glutathione S-transferase kappa 1 isoform d [Homo sapiens]
Sequence
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFL
TAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPK
VKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN
ARL
Download sequence
Identical sequences NP_001137153.1.87134 NP_001137153.1.92137 gi|219842335|ref|NP_001137153.1| ENSP00000415813 ENSP00000415813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]