SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22035550|ref|NP_005494.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22035550|ref|NP_005494.2|
Domain Number 1 Region: 364-529
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000232
Further Details:      
 
Domain Number 2 Region: 543-666
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 658-740
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22035550|ref|NP_005494.2|
Sequence length 749
Comment amyloid beta A4 precursor protein-binding family A member 2 isoform a [Homo sapiens]
Sequence
MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEE
YLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQ
EEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMT
SITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGF
KPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGP
CEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSAS
QDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQ
KEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANM
MNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTV
LIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQAL
SNSVGEIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences Q99767
9606.ENSP00000219865 ENSP00000409312 ENSP00000453144 ENSP00000453293 ENSP00000454171 ENSP00000480384 ENSP00000453144 ENSP00000453293 ENSP00000454171 NP_005494.2.87134 NP_005494.2.92137 XP_011519790.1.92137 XP_011519791.1.92137 XP_011519792.1.92137 XP_011519793.1.92137 XP_011519794.1.92137 XP_016877590.1.92137 XP_016877591.1.92137 XP_016877592.1.92137 XP_016877593.1.92137 XP_016877594.1.92137 XP_016877595.1.92137 XP_016877596.1.92137 XP_016877597.1.92137 XP_016877598.1.92137 XP_016877599.1.92137 XP_016877600.1.92137 XP_016877601.1.92137 gi|22035550|ref|NP_005494.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]