SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22035554|ref|NP_663722.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22035554|ref|NP_663722.1|
Domain Number 1 Region: 335-503
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-36
Family Phosphotyrosine-binding domain (PTB) 0.0059
Further Details:      
 
Domain Number 2 Region: 526-658
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000107
Further Details:      
 
Domain Number 3 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000117
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22035554|ref|NP_663722.1|
Sequence length 708
Comment amyloid beta A4 precursor protein-binding family B member 1 isoform delta E9 [Homo sapiens]
Sequence
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL
ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLP
EPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF
RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQK
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG
ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCL
DARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
Download sequence
Identical sequences gi|22035554|ref|NP_663722.1| ENSP00000299402 ENSP00000311912 9606.ENSP00000299402 ENSP00000299402 ENSP00000311912 hso001000019.1 NP_663722.1.87134 NP_663722.1.92137 XP_016873130.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]