SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22091454|ref|NP_665683.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22091454|ref|NP_665683.1|
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.08e-45
Family Glutathione S-transferase (GST), C-terminal domain 0.0000527
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-31
Family Glutathione S-transferase (GST), N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22091454|ref|NP_665683.1|
Sequence length 222
Comment glutathione S-transferase A1 [Homo sapiens]
Sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
Download sequence
Identical sequences A0A140VJK4 P08263
ENSP00000335620 9606.ENSP00000335620 1pkw_A 1pkw_B 1pkz_A 1pkz_B 1pl1_A 1pl1_B ENSP00000335620 NP_665683.1.87134 NP_665683.1.92137 400154 1pl1A gi|22091454|ref|NP_665683.1| ENSP00000335620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]