SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221136957|ref|NP_001137475.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221136957|ref|NP_001137475.1|
Domain Number 1 Region: 39-263
Classification Level Classification E-value
Superfamily L domain-like 1.12e-35
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 353-566
Classification Level Classification E-value
Superfamily L domain-like 1.25e-35
Family Ngr ectodomain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221136957|ref|NP_001137475.1|
Sequence length 845
Comment SLIT and NTRK-like protein 2 precursor [Homo sapiens]
Sequence
MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNN
KLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
VLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
IVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPK
ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQ
ERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFT
NLTSLRRLYLNGNYLEVLYPSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNN
NLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGL
KDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPR
SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNL
DVSSFQLQYGSYNTETHDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSY
SNLEEKKEEPATPAYTISATELLEKQATPREPELLYQNIAERVKELPSAGLVHYNFCTLP
KRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAKPQSEPDYLEVLEKQT
AISQL
Download sequence
Identical sequences Q9H156
ENSP00000359521 ENSP00000359521 ENSP00000397015 ENSP00000407347 ENSP00000411681 ENSP00000412010 ENSP00000468887 ENSP00000469687 ENSP00000471447 ENSP00000472603 ENSP00000472699 gi|221136957|ref|NP_001137475.1| gi|221136961|ref|NP_001137476.1| gi|221136965|ref|NP_001137477.1| gi|221136969|ref|NP_001137478.1| gi|221136977|ref|NP_001137480.1| gi|221136981|ref|NP_001137481.1| gi|221136985|ref|NP_001137482.1| gi|33504581|ref|NP_115928.1| ENSP00000359521 9606.ENSP00000359521 NP_001137475.1.87134 NP_001137475.1.92137 NP_001137476.1.87134 NP_001137476.1.92137 NP_001137477.1.87134 NP_001137477.1.92137 NP_001137478.1.87134 NP_001137478.1.92137 NP_001137480.1.87134 NP_001137480.1.92137 NP_001137481.1.87134 NP_001137481.1.92137 NP_001137482.1.87134 NP_001137482.1.92137 NP_115928.1.87134 NP_115928.1.92137 XP_005262399.1.92137 XP_005262400.1.92137 XP_005262401.1.92137 XP_005262402.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]