SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221316659|ref|NP_001137467.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221316659|ref|NP_001137467.1|
Domain Number 1 Region: 183-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.34e-20
Family LIM domain 0.0078
Further Details:      
 
Domain Number 2 Region: 242-304
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.52e-19
Family LIM domain 0.00077
Further Details:      
 
Domain Number 3 Region: 301-363
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.26e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 156-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000373
Family LIM domain 0.011
Further Details:      
 
Domain Number 5 Region: 360-389
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000113
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221316659|ref|NP_001137467.1|
Sequence length 391
Comment leupaxin isoform 1 [Homo sapiens]
Sequence
MSTLLISSSDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSP
LPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGK
KHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEH
FVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHF
FCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFV
CGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVC
AFCLTQLSKGIFREQNDKTYCQPCFNKLFPL
Download sequence
Identical sequences ENSP00000431284 gi|221316659|ref|NP_001137467.1| ENSP00000431284 ENSP00000431284 NP_001137467.1.87134 NP_001137467.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]