SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221554549|ref|NP_001137434.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221554549|ref|NP_001137434.1|
Domain Number 1 Region: 9-351
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.45e-136
Family Calpain large subunit, catalytic domain (domain II) 0.00000000014
Further Details:      
 
Domain Number 2 Region: 356-515
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.53e-52
Family Calpain large subunit, middle domain (domain III) 0.00000156
Further Details:      
 
Domain Number 3 Region: 532-701
Classification Level Classification E-value
Superfamily EF-hand 1.85e-44
Family Penta-EF-hand proteins 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221554549|ref|NP_001137434.1|
Sequence length 703
Comment calpain-8 [Homo sapiens]
Sequence
MAAQAAGVSRQRAATQGLGSNQNALKYLGQDFKTLRQQCLDSGVLFKDPEFPACPSALGY
KDLGPGSPQTQGIIWKRPTELCPSPQFIVGGATRTDICQGGLGDCWLLAAIASLTLNEEL
LYRVVPRDQDFQENYAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSAL
LEKAYAKLNGCYEALAGGSTVEGFEDFTGGISEFYDLKKPPANLYQIIRKALCAGSLLGC
SIDVSSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEKLIRLRNPWGEVEWSGAWSDD
APEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICNLSPDSLSSEEVHKWNLVL
FNGHWTRGSTAGGCQNYPATYWTNPQFKIRLDEVDEDQEESIGEPCCTVLLGLMQKNRRW
RKRIGQGMLSIGYAVYQVPKELESHTDAHLGRDFFLAYQPSARTSTYVNLREVSGRARLP
PGEYLVVPSTFEPFKDGEFCLRVFSEKKAQALEIGDVVAGNPYEPHPSEVDQEDDQFRRL
FEKLAGKDSEITANALKILLNEAFSKRTDIKFDGFNINTCREMISLLDSNGTGTLGAVEF
KTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTALRKAGFTLNSQVQQTIALRYACSKLGI
NFDSFVACMIRLETLFKLFSLLDEDKDGMVQLSLAEWLCCVLV
Download sequence
Identical sequences A6NHC0
ENSP00000355837 gi|221554549|ref|NP_001137434.1| NP_001137434.1.87134 NP_001137434.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]