SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221625547|ref|NP_001138244.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221625547|ref|NP_001138244.1|
Domain Number 1 Region: 314-606
Classification Level Classification E-value
Superfamily BEACH domain 1.28e-117
Family BEACH domain 0.0000000626
Further Details:      
 
Domain Number 2 Region: 645-946
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-56
Family WD40-repeat 0.0009
Further Details:      
 
Domain Number 3 Region: 223-316
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-17
Family PreBEACH PH-like domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221625547|ref|NP_001138244.1|
Sequence length 948
Comment protein FAN isoform 2 [Homo sapiens]
Sequence
MTGQARFHRGAEACRAIRQCRSRRPRAAHPEGRAGSGRGSRHASPGVRRGGFSLLLLNLE
EYYFEQHRANHILHKGSHHERKIRGSLKICSKSVIFEPDSISQPIIKIPLRDCIKIGKHG
ENGANRHFTKAKSGGISLIFSQVYFIKEHNVVAPYKIERGKMEYVFELDVPGKVEDVVET
LLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAEMVTPLVTN
PGHVCITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIY
LKFYEPQDRDDLYFYIATYLEHHVAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCND
LSQYPVFPWIIHDYSSSELDLSNPGTFRDLSKPVGALNKERLERLLTRYQEMPEPKFMYG
SHYSSPGYVLFYLVRIAPEYMLCLQNGRFDNADRMFNSIAETWKNCLDGATDFKELIPEF
YGDDVSFLVNSLKLDLGKRQGGQMVDDVELPPWASSPEDFLQKSKDALESNYVSEHLHEW
IDLIFGYKQKGSDAVGAHNVFHPLTYEGGVDLNSIQDPDEKVAMLTQILEFGQTPKQLFV
TPHPRRITPKFKSLSQTSSYNASMADSPGEESFEDLTEESKTLAWNNITKLQLHEHYKIH
KEAVTGITVSRNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVIT
SSWDNNVYFYSIAFGRRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMPGT
KRHHFDLLAELEHDVSVDTISLNAASTLLVSGTKEGTVNIWDLTTATLMHQIPCHSGIVC
DTAFSPDSRHVLSTGTDGCLNVIDVQTGMLISSMTSDEPQRCFVWDGNSVLSGSQSGELL
VWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQIIFWKLQY
Download sequence
Identical sequences ENSP00000411012 NP_001138244.1.87134 NP_001138244.1.92137 9606.ENSP00000411012 ENSP00000411012 gi|221625547|ref|NP_001138244.1| ENSP00000411012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]