SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22202624|ref|NP_665877.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22202624|ref|NP_665877.1|
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.54e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000334
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22202624|ref|NP_665877.1|
Sequence length 216
Comment maleylacetoacetate isomerase isoform 1 [Homo sapiens]
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Download sequence
Identical sequences A0A0C4DFM0
ENSP00000216465 gi|22202624|ref|NP_665877.1| 400306 ENSP00000216465 9606.ENSP00000216465 NP_665877.1.87134 NP_665877.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]