SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222080062|ref|NP_066552.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222080062|ref|NP_066552.2|
Domain Number 1 Region: 55-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.31e-64
Family NQO2-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222080062|ref|NP_066552.2|
Sequence length 249
Comment NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial precursor [Homo sapiens]
Sequence
MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
Download sequence
Identical sequences P19404
NP_066552.2.87134 NP_066552.2.92137 HR6661 ENSP00000327268 ENSP00000327268 gi|222080062|ref|NP_066552.2| 9606.ENSP00000327268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]