SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222080068|ref|NP_001138328.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222080068|ref|NP_001138328.1|
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-49
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-23
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222080068|ref|NP_001138328.1|
Sequence length 790
Comment pleckstrin homology domain-containing family G member 6 isoform a [Homo sapiens]
Sequence
MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVLDPSRRRLQQYVPFA
RGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKELTKAHELEVRLHTFSMFGMPR
LPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLTTELIYVRKL
KIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQP
LDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ
MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQ
ESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEF
QCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLYRDQDRESPST
RPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGTLIPGTPTG
SRSPLSRLRQRALRRDPRLTFSTLELRDIPLRPHPPDPQAPQRRSAPELPEGILKGGSLP
QEDPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGP
LFLKAGHTSLRPMRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQ
LDTPLSASEV
Download sequence
Identical sequences Q3KR16
gi|222080066|ref|NP_060643.2| gi|222080068|ref|NP_001138328.1| NP_001138328.1.87134 NP_001138328.1.92137 NP_060643.2.87134 NP_060643.2.92137 XP_005253761.1.92137 ENSP00000011684 ENSP00000380185 ENSP00000011684 ENSP00000380185 ENSP00000011684 9606.ENSP00000011684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]