SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22212896|ref|NP_671709.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22212896|ref|NP_671709.1|
Domain Number 1 Region: 14-166
Classification Level Classification E-value
Superfamily EF-hand 2.01e-43
Family Calmodulin-like 0.0000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22212896|ref|NP_671709.1|
Sequence length 173
Comment calcineurin subunit B type 2 [Homo sapiens]
Sequence
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Download sequence
Identical sequences A0A2J8WSD1
gi|22212896|ref|NP_671709.1| ENSP00000363939 9606.ENSP00000363939 ENSP00000363939 ENSP00000363939 hsi002022320.1 NP_671709.1.87134 NP_671709.1.92137 XP_004048426.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]