SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22212902|ref|NP_671712.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22212902|ref|NP_671712.1|
Domain Number 1 Region: 47-213
Classification Level Classification E-value
Superfamily EF-hand 1.02e-71
Family SCOPe 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22212902|ref|NP_671712.1|
Sequence length 229
Comment Kv channel-interacting protein 4 isoform 4 [Homo sapiens]
Sequence
MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSK
FTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVS
FEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLK
EDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Download sequence
Identical sequences A0A1S2ZYG2 A0A1S3EL19 A0A1U7QLT4 A0A287CSP0 A0A2I3HLS7 A0A2I3LUX8 A0A2I3RNG2 A0A2J8ULD4 A0A2K5CAB8 A0A2K5JQA6 A0A2K5LSD5 A0A2K5PIX7 A0A2K5W379 A0A2K5YTY8 A0A2K6BUZ8 A0A2K6KAP0 A0A2K6N8G5 A0A2K6V081 F7EPR7 Q3YAA6 U3F074
ENSMUSP00000134758 ENSP00000371585 NP_084541.3.92730 NP_671712.1.87134 NP_671712.1.92137 XP_002709421.1.1745 XP_002745995.1.60252 XP_003258570.1.23891 XP_003434448.1.84170 XP_003482402.1.46622 XP_003826872.1.60992 XP_003927526.1.74449 XP_004375199.1.4749 XP_004415221.1.74151 XP_004482529.1.11602 XP_004579236.1.84141 XP_004616601.1.94378 XP_004624595.1.9945 XP_004656145.1.11716 XP_004762750.1.14098 XP_005068842.1.91757 XP_005366071.1.66349 XP_005402527.1.28644 XP_005554624.1.63531 XP_006184763.1.101512 XP_006208182.1.17985 XP_006884570.1.29581 XP_006919026.1.64745 XP_006976161.1.50099 XP_007526512.1.11023 XP_008015967.1.81039 XP_008684064.1.72690 XP_010375512.1.97406 XP_010589691.1.64505 XP_010608735.1.5607 XP_010989344.1.51371 XP_011363456.1.92234 XP_011749799.1.29376 XP_011791064.1.43180 XP_011849654.1.47321 XP_011900732.1.92194 XP_012327768.1.9421 XP_012593135.1.48125 XP_012864640.1.60039 XP_014993546.1.72884 XP_015337480.1.40921 XP_017396101.1.71028 XP_017454576.1.100692 XP_017536462.1.32401 XP_017722296.1.44346 XP_019309452.1.44245 XP_019685254.1.62641 XP_020008413.1.5219 XP_021066789.1.100879 XP_021535077.1.83697 XP_526537.2.37143 ENSP00000371585 3dd4_A gi|22212902|ref|NP_671712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]