SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222352143|ref|NP_060891.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222352143|ref|NP_060891.3|
Domain Number 1 Region: 613-777
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.43e-44
Family Ypt/Rab-GAP domain of gyp1p 0.00094
Further Details:      
 
Domain Number 2 Region: 755-862
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-21
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 
Domain Number 3 Region: 48-151
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-19
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222352143|ref|NP_060891.3|
Sequence length 917
Comment TBC1 domain family member 2A [Homo sapiens]
Sequence
MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCGYLSKFGGKGP
IRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGIFEIKTPSRVI
TLKAATKQAMLYWLQQLQMKRWEFHNSPPAPPATPDAALAGNGPVLHLELGQEEAELEEF
LCPVKTPPGLVGVAAALQPFPALQNISLKHLGTEIQNTMHNIRGNKQAQGTGHEPPGEDS
PQSGEPQREEQPLASDASTPGREPEDSPKPAPKPSLTISFAQKAKRQNNTFPFFSEGITR
NRTAQEKVAALEQQVLMLTKELKSQKELVKILHKALEAAQQEKRASSAYLAAAEDKDRLE
LVRHKVRQIAELGRRVEALEQERESLAHTASLREQQVQELQQHVQLLMDKNHAKQQVICK
LSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTK
IWRKVAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEAL
QWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLLAKIQALESRSHHLLGLEAVDR
PLRERWAALGDLVPSAELKQLLRAGVPREHRPRVWRWLVHLRVQHLHTPGCYQELLSRGQ
AREHPAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAA
IALLVLEEEESAFWCLVAIVETIMPADYYCNTLTASQVDQRVLQDLLSEKLPRLMAHLGQ
HHVDLSLVTFNWFLVVFADSLISNILLRVWDAFLYEGTKYNEKEILRLQNGLEIYQYLRF
FTKTISNSRKLMNIAFNDMNPFRMKQLRQLRMVHRERLEAELRELEQLKAEYLERRASRR
RAVSEGCASEDEVEGEA
Download sequence
Identical sequences gi|222352143|ref|NP_060891.3| 9606.ENSP00000364207 ENSP00000364203 ENSP00000364207 NP_060891.3.87134 NP_060891.3.92137 ENSP00000364207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]