SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222352166|ref|NP_963845.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222352166|ref|NP_963845.1|
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.86e-37
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000408
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 635-707
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000408
Family VWC domain 0.022
Further Details:      
 
Domain Number 4 Region: 427-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 467-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000406
Family EGF-like domain of nidogen-1 0.065
Further Details:      
 
Domain Number 6 Region: 549-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000252
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000502
Family VWC domain 0.034
Further Details:      
 
Domain Number 8 Region: 514-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  gi|222352166|ref|NP_963845.1|
Domain Number - Region: 577-640
Classification Level Classification E-value
Superfamily FnI-like domain 0.000167
Family VWC domain 0.023
Further Details:      
 
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 718-755
Classification Level Classification E-value
Superfamily FnI-like domain 0.0649
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222352166|ref|NP_963845.1|
Sequence length 763
Comment protein kinase C-binding protein NELL1 isoform 2 precursor [Homo sapiens]
Sequence
MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVW
TLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGD
NWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTC
LDSYGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDFECLQNN
Download sequence
Identical sequences ENSP00000437170 ENSP00000437170 NP_963845.1.87134 NP_963845.1.92137 gi|222352166|ref|NP_963845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]