SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222418696|ref|NP_001138405.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222418696|ref|NP_001138405.1|
Domain Number 1 Region: 10-43,99-174
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000926
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222418696|ref|NP_001138405.1|
Sequence length 490
Comment EF-hand calcium-binding domain-containing protein 3 isoform a [Homo sapiens]
Sequence
MKELMPHLTFNGNGKINVNSIMEGLKKFKPKGMVTLHKLKTANDIKDRVTGHMAVSEIKP
KLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCID
FHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKET
CLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKR
TLKPDICTPPSSSMAAFANAARIAIMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPN
VDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNIFT
IDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGMDSRN
ESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSECYTDSGRKR
KRKGLKGFQQ
Download sequence
Identical sequences 9606.ENSP00000403932 gi|222418696|ref|NP_001138405.1| NP_001138405.1.87134 NP_001138405.1.92137 ENSP00000403932 ENSP00000302649 ENSP00000403932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]