SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222418791|ref|NP_001138430.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222418791|ref|NP_001138430.1|
Domain Number 1 Region: 542-709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-52
Family G proteins 0.0000196
Further Details:      
 
Domain Number 2 Region: 51-122
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000857
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222418791|ref|NP_001138430.1|
Sequence length 731
Comment EF-hand calcium-binding domain-containing protein 4B isoform a [Homo sapiens]
Sequence
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQ
TCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
NNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVK
QLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEM
EQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE
TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQR
EKAGLLKQLDFLRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRG
ILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPS
APDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWD
TAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL
DNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQV
GHPAKKKSCCG
Download sequence
Identical sequences NP_001138430.1.87134 NP_001138430.1.92137 9606.ENSP00000409382 gi|222418791|ref|NP_001138430.1| ENSP00000409382 ENSP00000409382 ENSP00000252322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]