SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223005922|ref|NP_001138549.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223005922|ref|NP_001138549.1|
Domain Number 1 Region: 22-221
Classification Level Classification E-value
Superfamily L domain-like 1.5e-39
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223005922|ref|NP_001138549.1|
Sequence length 292
Comment leucine-rich repeat-containing protein 10B [Homo sapiens]
Sequence
MGIAESTPDELPSDAEEQLRSGDQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELP
EEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFAQLQSLRCLWI
EGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLR
MGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVERMAER
DEPTPRPPPRRPARAFEDEEEEDLLIGGAGSRALGAPGGSFRALEAAPGLGT
Download sequence
Identical sequences A6NIK2
gi|223005922|ref|NP_001138549.1| 9606.ENSP00000367315 ENSP00000367315 ENSP00000367315 NP_001138549.1.87134 NP_001138549.1.92137 ENSP00000367315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]