SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223029474|ref|NP_001138581.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223029474|ref|NP_001138581.1|
Domain Number 1 Region: 29-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-42
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 477-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000369
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 431-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000883
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 687-759
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000565
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 594-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000241
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|223029474|ref|NP_001138581.1|
Domain Number - Region: 323-397
Classification Level Classification E-value
Superfamily FnI-like domain 0.000188
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 397-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00322
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223029474|ref|NP_001138581.1|
Sequence length 815
Comment protein kinase C-binding protein NELL2 isoform c [Homo sapiens]
Sequence
METGLGAPLFKAWLLISVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQ
DTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGH
RNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPST
DLPLGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKI
MELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTI
QCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYEC
KDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRAV
CSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCT
EHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVC
ACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCE
DIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCS
VCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQ
CRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDITKTCLDEMNVVR
FTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences ENSP00000378866 ENSP00000447927 gi|223029474|ref|NP_001138581.1| NP_001138581.1.87134 NP_001138581.1.92137 ENSP00000378866 ENSP00000447927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]