SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223468608|ref|NP_001138594.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223468608|ref|NP_001138594.1|
Domain Number 1 Region: 8-343
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.27e-116
Family Calpain large subunit, catalytic domain (domain II) 0.000000084
Further Details:      
 
Domain Number 2 Region: 348-496
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.57e-36
Family Calpain large subunit, middle domain (domain III) 0.0000872
Further Details:      
 
Domain Number 3 Region: 513-672
Classification Level Classification E-value
Superfamily EF-hand 7.87e-27
Family Penta-EF-hand proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223468608|ref|NP_001138594.1|
Sequence length 684
Comment calpain-14 [Homo sapiens]
Sequence
MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGS
LLQKLPPRLQWKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRV
VPLNQSFTEKYAGIFRFWFWHYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEK
AYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEAHGNLWDILIEATYNRTLIGCQTH
SGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPWGKVEWKGDWSDSSSKWELLS
PKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTYTMREGRWEKR
STAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEA
HQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQN
LLNQMTWSSLGSRQPFFSLEACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQD
RGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGGPRLQMDFVSFIHLMLRVENMEDVF
QNLTQDGKGIYLQKPEWMMMALYS
Download sequence
Identical sequences A8MX76
NP_001138594.1.87134 NP_001138594.1.92137 XP_011531165.1.92137 XP_011531166.1.92137 XP_011531167.1.92137 9606.ENSP00000385247 ENSP00000385247 ENSP00000385247 ENSP00000385247 gi|223468608|ref|NP_001138594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]