SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|223718151|ref|NP_001138779.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223718151|ref|NP_001138779.1|
Domain Number 1 Region: 52-147
Classification Level Classification E-value
Superfamily L domain-like 1.63e-16
Family Internalin LRR domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223718151|ref|NP_001138779.1|
Sequence length 158
Comment leucine-rich repeat-containing protein 51 isoform 2 [Homo sapiens]
Sequence
MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNV
LNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEV
NKLAVLPRLRSLTLHGNPMEEEKGYRVPGSVEMPHRPP
Download sequence
Identical sequences A0A2J8PZY7
gi|223718151|ref|NP_001138779.1| ENSP00000414271 ENSP00000438522 NP_001138779.1.87134 NP_001138779.1.92137 XP_016775418.1.37143 ENSP00000438522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]