SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224451128|ref|NP_001136272.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224451128|ref|NP_001136272.1|
Domain Number 1 Region: 2670-2879
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-35
Family Laminin G-like module 0.00061
Further Details:      
 
Domain Number 2 Region: 2937-3124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-27
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 2127-2334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-25
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 4 Region: 2395-2582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-23
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 5 Region: 1184-1202,1887-2047
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-19
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 6 Region: 1004-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000028
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 928-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000617
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 992-1122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 771-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000567
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 809-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 681-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000746
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 12 Region: 890-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000794
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 214-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000862
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 14 Region: 1127-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 853-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000015
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 733-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.014
Further Details:      
 
Domain Number 17 Region: 1158-1197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000854
Family EGF-type module 0.007
Further Details:      
 
Domain Number 18 Region: 2334-2372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 571-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.028
Further Details:      
 
Domain Number 20 Region: 643-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|224451128|ref|NP_001136272.1|
Domain Number - Region: 178-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 2876-2913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000138
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 372-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family EGF-type module 0.0089
Further Details:      
 
Domain Number - Region: 258-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 2611-2653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000569
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 334-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000794
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 715-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000966
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 409-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0204
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224451128|ref|NP_001136272.1|
Sequence length 3144
Comment protein eyes shut homolog isoform 1 [Homo sapiens]
Sequence
MTDKSIVILSLMVFHSSFINGKTCRRQLVEEWHPQPSSYVVNWTLTENICLDFYRDCWFL
GVNTKIDTSGNQAVPQICPLQIQLGDILVISSEPSLQFPEINLMNVSETSFVGCVQNTTT
EDQLLFGCRLKGMHTVNSKWLSVGTHYFITVMASGPSPCPLGLRLNVTVKQQFCQESLSS
EFCSGHGKCLSEAWSKTYSCHCQPPFSGKYCQELDACSFKPCKNNGSCINKRENWDEQAY
ECVCHPPFTGKNCSEIIGQCQPHVCFHGNCSNITSNSFICECDEQFSGPFCEVSAKPCVS
LLFWKRGICPNSSSAYTYECPKGSSSQNGETDVSEFSLVPCQNGTDCIKISNDVMCICSP
IFTDLLCKSIQTSCESFPLRNNATCKKCEKDYPCSCISGFTEKNCEKAIDHCKLLSINCL
NEEWCFNIIGRFKYVCIPGCTKNPCWFLKNVYLIHQHLCYCGVTFHGICQDKGPAQFEYV
WQLGFAGSEGEKCQGVIDAYFFLAANCTEDATYVNDPEDNNSSCWFPHEGTKEICANGCS
CLSEEDSQEYRYLCFLRWAGNMYLENTTDDQENECQHEAVCKDEINRPRCSCSLSYIGRL
CVVNVDYCLGNHSISVHGLCLALSHNCNCSGLQRYERNICEIDTEDCKSASCKNGTTSTH
LRGYFFRKCVPGFKGTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCL
CNPGYVGIRCEQDIDDCILNACEHNSTCKDLHLSYQCVCLSDWEGNFCEQESNECKMNPC
KNNSTCTDLYKSYRCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPL
YTGQFCHQRYNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQ
DYGDCEDMVNNFRCICRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPEYHG
PFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGYTGINCEINLDECLSEPCLHDGVCI
DGINHYTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINEYPCSCDADGTSTQCKIKI
NDCTSIPCMNEGFCQKSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDG
PGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGYVCKCQPGWSGHHCENEL
ECIPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQT
YTIPPSETLVSSFPSIKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLE
SYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDKTSVSHMPIRTSAATL
GFFFPDRRARTPFIMSSLMSDFIFPTQSLLFENCQTVALSATPTTSVIRSIPGADIELNR
QSLLSRGFLLIAASISATPVVSRGAQEDIEEYSADSLISRREHWRLLSPSMSPIFPAKVI
ISKQVTILNSSALHRFSTKAFNPSEYQAITEASSNQRLTNIKSQAADSLRELSQTCATCS
MTEIKSSREFSDQVLHSKQSHFYETFWMNSAILASWYALMGAQTITSGHSFSSATEITPS
VAFTEVPSLFPSKKSAKRTILSSSLEESITLSSNLDVNLCLDKTCLSIVPSQTISSDLMN
SDLTSKMTTDELSVSENILKLLKIRQYGITMGPTEVLNQESLLDMEKSKGSHTLFKLHPS
DSSLDFELNLQIYPDVTLKTYSEITHANDFKNNLPPLTGSVPDFSEVTTNVAFYTVSATP
ALSIQTSSSMSVIRPDWPYFTDYMTSLKKEVKTSSEWSKWELQPSVQYQEFPTASRHLPF
TRSLTLSSLESILAPQRLMISDFSCVRYYGDSYLEFQNVALNPQNNISLEFQTFSSYGLL
LYVKQDSNLVDGFFIQLFIENGTLKYHFYCPGEAKFKSINTTVRVDNGQKYTLLIRQELD
PCNAELTILGRNTQICESINHVLGKPLPKSGSVFIGGFPDLHGKIQMPVPVKNFTGCIEV
IEINNWRSFIPSKAVKNYHINNCRSQGFMLSPTASFVDASDVTQGVDTMWTSVSPSVAAP
SVCQQDVCHNGGTCHAIFLSSGIVSFQCDCPLHFTGRFCEKDAGLFFPSFNGNSYLELPF
LKFVLEKEHNRTVTIYLTIKTNSLNGTILYSNGNNCGKQFLHLFLVEGRPSVKYGCGNSQ
NILTVSANYSINTNAFTPITIRYTTPVGSPGVVCMIEMTADGKPPVQKKDTEISHASQAY
FESMFLGHIPANVQIHKKAGPVYGFRGCILDLQVNNKEFFIIDEARHGKNIENCHVPWCA
HHLCRNNGTCISDNENLFCECPRLYSGKLCQFASCENNPCGNGATCVPKSGTDIVCLCPY
GRSGPLCTDAINITQPRFSGTDAFGYTSFLAYSRISDISFHYEFHLKFQLANNHSALQNN
LIFFTGQKGHGLNGDDFLAVGLLNGSVVYSYNLGSGIASIRSEPLNLSLGVHTVHLGKFF
QEGWLKVDDHKNKSIIAPGRLVGLNVFSQFYVGGYSEYTPDLLPNGADFKNGFQGCIFTL
QVRTEKDGHFRGLGNPEGHPNAGRSVGQCHASPCSLMKCGNGGTCIESGTSVYCNCTTGW
KGSFCTETVSTCDPEHDPPHHCSRGATCISLPHGYTCFCPLGTTGIYCEQALSISDPSFR
SNELSWMSFASFHVRKKTHIQLQFQPLAADGILFYAAQHLKAQSGDFLCISLVNSSVQLR
YNLGDRTIILETLQKVTINGSTWHIIKAGRVGAEGYLDLDGINVTEKASTKMSSLDTNTD
FYIGGVSSLNLVNPMAIENEPVGFQGCIRQVIINNQELQLTEFGAKGGSNVGDCDGTACG
YNTCRNGGECTVNGTTFSCRCLPDWAGNTCNQSVSCLNNLCLHQSLCIPDQSFSYSCLCT
LGWVGRYCENKTSFSTAKFMGNSYIKYIDPNYRMRNLQFTTISLNFSTTKTEGLIVWMGI
AQNEENDFLAIGLHNQTLKIAVNLGERISVPMSYNNGTFCCNKWHHVVVIQNQTLIKAYI
NNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQE
PKNIELIKLEGYNVYDGDEQNEVT
Download sequence
Identical sequences 9606.ENSP00000359652 gi|224451128|ref|NP_001136272.1| ENSP00000424243 NP_001136272.1.87134 NP_001136272.1.92137 ENSP00000359652 ENSP00000424243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]