SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224451131|ref|NP_001136273.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224451131|ref|NP_001136273.1|
Domain Number 1 Region: 214-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 2 Region: 178-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.042
Further Details:      
 
Domain Number 3 Region: 372-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000315
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 258-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  gi|224451131|ref|NP_001136273.1|
Domain Number - Region: 334-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000149
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 409-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00329
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224451131|ref|NP_001136273.1|
Sequence length 619
Comment protein eyes shut homolog isoform 2 [Homo sapiens]
Sequence
MTDKSIVILSLMVFHSSFINGKTCRRQLVEEWHPQPSSYVVNWTLTENICLDFYRDCWFL
GVNTKIDTSGNQAVPQICPLQIQLGDILVISSEPSLQFPEINLMNVSETSFVGCVQNTTT
EDQLLFGCRLKGMHTVNSKWLSVGTHYFITVMASGPSPCPLGLRLNVTVKQQFCQESLSS
EFCSGHGKCLSEAWSKTYSCHCQPPFSGKYCQELDACSFKPCKNNGSCINKRENWDEQAY
ECVCHPPFTGKNCSEIIGQCQPHVCFHGNCSNITSNSFICECDEQFSGPFCEVSAKPCVS
LLFWKRGICPNSSSAYTYECPKGSSSQNGETDVSEFSLVPCQNGTDCIKISNDVMCICSP
IFTDLLCKSIQTSCESFPLRNNATCKKCEKDYPCSCISGFTEKNCEKAIDHCKLLSINCL
NEEWCFNIIGRFKYVCIPGCTKNPCWFLKNVYLIHQHLCYCGVTFHGICQDKGPAQFEYV
WQLGFAGSEGEKCQGVIDAYFFLAANCTEDATYVNDPEDNNSSCWFPHEGTKEICANGCS
CLSEEDSQEYRYLCFLRWAGNMYLENTTDDQENECQHEAVCKDEINRPRRILNTVIPHQI
QQHIERFIQHDQVGFIVRI
Download sequence
Identical sequences ENSP00000377042 gi|224451131|ref|NP_001136273.1| NP_001136273.1.87134 NP_001136273.1.92137 ENSP00000377042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]