SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224493972|ref|NP_001139021.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224493972|ref|NP_001139021.1|
Domain Number 1 Region: 78-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-33
Family PDI-like 0.0074
Further Details:      
 
Domain Number 2 Region: 212-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-33
Family PDI-like 0.0044
Further Details:      
 
Domain Number 3 Region: 3-60
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000253
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224493972|ref|NP_001139021.1|
Sequence length 324
Comment thioredoxin domain-containing protein 5 isoform 3 [Homo sapiens]
Sequence
MEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTL
NEEPVTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWE
QLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLRE
YVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAP
WCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKV
SEHSGGRDLDSLHRFVLSQAKDEL
Download sequence
Identical sequences A0A024QZV0
ENSP00000420784 gi|224493972|ref|NP_001139021.1| ENSP00000420784 NP_001139021.1.87134 NP_001139021.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]