SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224593260|ref|NP_689826.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224593260|ref|NP_689826.2|
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-21
Family VPS36 N-terminal domain-like 0.081
Further Details:      
 
Weak hits

Sequence:  gi|224593260|ref|NP_689826.2|
Domain Number - Region: 180-279
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00314
Family Adhesin YadA, collagen-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224593260|ref|NP_689826.2|
Sequence length 309
Comment postacrosomal sheath WW domain-binding protein [Homo sapiens]
Sequence
MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIF
ITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNG
DAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPA
GYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGA
PPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPQESTAAQAPENEASLP
SASSSQVHS
Download sequence
Identical sequences Q6ICG8
ENSP00000328800 ENSP00000332983 ENSP00000401002 NP_689826.2.87134 NP_689826.2.92137 9606.ENSP00000328800 ENSP00000332983 ENSP00000328800 ENSP00000332983 ENSP00000401002 gi|224593260|ref|NP_689826.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]