SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224994221|ref|NP_001139328.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224994221|ref|NP_001139328.1|
Domain Number 1 Region: 60-186
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-23
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 507-612
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000018
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|224994221|ref|NP_001139328.1|
Sequence length 618
Comment SH3 domain-binding protein 2 isoform b [Homo sapiens]
Sequence
MAGSGPRPRSWGRREAGARDEAAAAGGRGPGPCRCSQGRRAWIAPGKPAMPAAWTPFMAA
EEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKS
STSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMA
LLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSY
LEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHG
LPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRESASP
SPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFLKIA
EEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDGQSF
RSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDG
LYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVL
PSHQSLLLRHPYGYTGPR
Download sequence
Identical sequences ENSP00000422168 ENSP00000423823 gi|224994221|ref|NP_001139328.1| NP_001139328.1.87134 NP_001139328.1.92137 ENSP00000422168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]