SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22547146|ref|NP_060848.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22547146|ref|NP_060848.2|
Domain Number 1 Region: 7-46
Classification Level Classification E-value
Superfamily F-box domain 0.000000000128
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 128-204,317-355
Classification Level Classification E-value
Superfamily RNI-like 0.0000000373
Family Rna1p (RanGAP1), N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22547146|ref|NP_060848.2|
Sequence length 374
Comment F-box/LRR-repeat protein 8 [Homo sapiens]
Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGML
PPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAG
RDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGP
GSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNE
AWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYA
ATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLK
LTREPHPWRPTLVA
Download sequence
Identical sequences Q96CD0
ENSP00000258200 ENSP00000430490 9606.ENSP00000258200 ENSP00000258200 ENSP00000430490 gi|22547146|ref|NP_060848.2| NP_060848.2.87134 NP_060848.2.92137 ENSP00000258200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]