SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225703100|ref|NP_001139540.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225703100|ref|NP_001139540.1|
Domain Number 1 Region: 2-275
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.69e-117
Family Calpain large subunit, catalytic domain (domain II) 0.0000000000681
Further Details:      
 
Domain Number 2 Region: 278-435
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.14e-58
Family Calpain large subunit, middle domain (domain III) 0.0000000193
Further Details:      
 
Domain Number 3 Region: 447-619
Classification Level Classification E-value
Superfamily EF-hand 2.58e-45
Family Penta-EF-hand proteins 0.0000000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225703100|ref|NP_001139540.1|
Sequence length 622
Comment calpain-2 catalytic subunit isoform 2 [Homo sapiens]
Sequence
MEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGI
FHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGG
ATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKL
VKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRR
HEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCRNYP
NTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPE
ELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFC
IRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILR
RVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDR
SGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQ
LDPENTGTIELDLISWLCFSVL
Download sequence
Identical sequences A0A2I3TSI9 A0A2J8U2C7
ENSP00000413158 NP_001139540.1.87134 NP_001139540.1.92137 ENSP00000413158 gi|225703100|ref|NP_001139540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]