SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226246579|ref|NP_001139676.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226246579|ref|NP_001139676.1|
Domain Number 1 Region: 57-390
Classification Level Classification E-value
Superfamily Ras GEF 6.8e-67
Family Ras GEF 0.0027
Further Details:      
 
Domain Number 2 Region: 458-522
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  gi|226246579|ref|NP_001139676.1|
Domain Number - Region: 397-429
Classification Level Classification E-value
Superfamily EF-hand 0.00165
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226246579|ref|NP_001139676.1|
Sequence length 604
Comment RAS guanyl-releasing protein 4 isoform d [Homo sapiens]
Sequence
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKELVALQGQHPPCSANEDLLHLLTLSLDLFYTEDEIYELSYAR
EPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQE
DFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFR
KPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPS
TPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASS
KLDS
Download sequence
Identical sequences NP_001139676.1.87134 NP_001139676.1.92137 ENSP00000468483 ENSP00000468483 gi|226246579|ref|NP_001139676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]