SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226246584|ref|NP_001139678.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226246584|ref|NP_001139678.1|
Domain Number 1 Region: 57-270
Classification Level Classification E-value
Superfamily Ras GEF 1.01e-22
Family Ras GEF 0.018
Further Details:      
 
Domain Number 2 Region: 338-402
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  gi|226246584|ref|NP_001139678.1|
Domain Number - Region: 276-336
Classification Level Classification E-value
Superfamily EF-hand 0.000917
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226246584|ref|NP_001139678.1|
Sequence length 484
Comment RAS guanyl-releasing protein 4 isoform f [Homo sapiens]
Sequence
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITLSLDLFYTEDEIYELSYAR
EPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDPEGRGTISQE
DFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFLHTFHEVTFR
KPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPS
TPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASS
KLDS
Download sequence
Identical sequences gi|226246584|ref|NP_001139678.1| ENSP00000445966 ENSP00000445966 ENSP00000484345 NP_001139678.1.87134 NP_001139678.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]