SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226246586|ref|NP_001139679.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226246586|ref|NP_001139679.1|
Domain Number 1 Region: 57-362
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-48
Family Ras GEF 0.018
Further Details:      
 
Domain Number 2 Region: 430-494
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  gi|226246586|ref|NP_001139679.1|
Domain Number - Region: 369-427
Classification Level Classification E-value
Superfamily EF-hand 0.00149
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226246586|ref|NP_001139679.1|
Sequence length 576
Comment RAS guanyl-releasing protein 4 isoform g [Homo sapiens]
Sequence
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITALLELTELLASHNNYARYR
RTWAGCAGFRLPVLGVHLKDLVSLHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHP
PCSANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPK
PDRVTLGRHVEQLVESVFKNYDPEGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFS
REELTGYLLRASAICSKLGLAFLHTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLC
CHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQL
RHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
Download sequence
Identical sequences gi|226246586|ref|NP_001139679.1| NP_001139679.1.87134 NP_001139679.1.92137 ENSP00000293062 ENSP00000293062 ENSP00000479888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]