SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226342931|ref|NP_079101.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226342931|ref|NP_079101.3|
Domain Number 1 Region: 78-394
Classification Level Classification E-value
Superfamily RNI-like 1.73e-49
Family 28-residue LRR 0.081
Further Details:      
 
Domain Number 2 Region: 350-491
Classification Level Classification E-value
Superfamily L domain-like 3.4e-19
Family Ngr ectodomain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226342931|ref|NP_079101.3|
Sequence length 512
Comment podocan-like protein 1 isoform 1 [Homo sapiens]
Sequence
MAESGLAMWPSLLLLLLLPGPPPVAGLEDAAFPHLGESLQPLPRACPLRCSCPRVDTVDC
DGLDLRVFPDNITRAAQHLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEAF
ESLTQLQHLCVAHNKLSVAPQFLPRSLRVADLAANQVMEIFPLTFGEKPALRSVYLHNNQ
LSNAGLPPDAFRGSEAIATLSLSNNQLSYLPPSLPPSLERLHLQNNLISKVPRGALSRQT
QLRELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTTVPAGLPRTLAILHLGRNRIR
QVEAARLHGARGLRYLLLQHNQLGSSGLPAGALRPLRGLHTLHLYGNGLDRVPPALPRRL
RALVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHHRAFRRLRALRSLDLAGNQL
TRLPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLRVGDIGPGTWHELQA
LQVRHRLVSHTVPRAPPSPCLPCHVPNILVSW
Download sequence
Identical sequences Q6PEZ8
ENSP00000254320 ENSP00000345175 ENSP00000345175 gi|226342931|ref|NP_079101.3| 9606.ENSP00000254320 NP_079101.3.87134 NP_079101.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]