SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226342933|ref|NP_001139726.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226342933|ref|NP_001139726.1|
Domain Number 1 Region: 45-351
Classification Level Classification E-value
Superfamily L domain-like 1.39e-49
Family Ngr ectodomain-like 0.0088
Further Details:      
 
Domain Number 2 Region: 283-487
Classification Level Classification E-value
Superfamily L domain-like 2.92e-28
Family Ngr ectodomain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226342933|ref|NP_001139726.1|
Sequence length 510
Comment podocan-like protein 1 isoform 2 [Homo sapiens]
Sequence
MGRPTQWPSLLLLLLLPGPPPVAGLEDAAFPHLGESLQPLPRACPLRCSCPRVDTVDCDG
LDLRVFPDNITRAAQHLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEAFES
LTQLQHLCVAHNKLSVAPQFLPRSLRVADLAANQVMEIFPLTFGEKPALRSVYLHNNQLS
NAGLPPDAFRGSEAIATLSLSNNQLSYLPPSLPPSLERLHLQNNLISKVPRGALSRQTQL
RELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTTVPAGLPRTLAILHLGRNRIRQV
EAARLHGARGLRYLLLQHNQLGSSGLPAGALRPLRGLHTLHLYGNGLDRVPPALPRRLRA
LVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHHRAFRRLRALRSLDLAGNQLTR
LPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLRVGDIGPGTWHELQALQ
VRHRLVSHTVPRAPPSPCLPCHVPNILVSW
Download sequence
Identical sequences gi|226342933|ref|NP_001139726.1| ENSP00000442553 NP_001139726.1.87134 NP_001139726.1.92137 ENSP00000442553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]