SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226371613|ref|NP_001139753.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226371613|ref|NP_001139753.1|
Domain Number 1 Region: 23-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-35
Family Laminin G-like module 0.000000119
Further Details:      
 
Weak hits

Sequence:  gi|226371613|ref|NP_001139753.1|
Domain Number - Region: 234-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0208
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226371613|ref|NP_001139753.1|
Sequence length 287
Comment sex hormone-binding globulin isoform 4 precursor [Homo sapiens]
Sequence
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRGE
DSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
Download sequence
Identical sequences NP_001139753.1.87134 NP_001139753.1.92137 ENSP00000393426 ENSP00000393426 gi|226371613|ref|NP_001139753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]