SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226423858|ref|NP_851851.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226423858|ref|NP_851851.2|
Domain Number 1 Region: 310-503
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 136-276
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.66e-28
Family CRAL/TRIO domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226423858|ref|NP_851851.2|
Sequence length 555
Comment PRR5-ARHGAP8 fusion protein [Homo sapiens]
Sequence
MSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLPDQELFSLNE
GVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEELQRDKAAAAAVLGAVRKRPSV
VPMAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYL
KYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIK
VLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPP
TKTPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQ
TVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSL
RVTGCRQILRSLPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVS
SLSALVPLNMFTELLIEYYEKIFSTPEAPGEHGLAPWEQGSRAAPLQEAVPRTQATGLTK
PTLPPSPLMAARRRL
Download sequence
Identical sequences gi|226423858|ref|NP_851851.2| ENSP00000374423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]