SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226437632|ref|NP_001004339.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226437632|ref|NP_001004339.2|
Domain Number 1 Region: 381-635,664-745
Classification Level Classification E-value
Superfamily ARM repeat 5.38e-39
Family Armadillo repeat 0.064
Further Details:      
 
Domain Number 2 Region: 99-307
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000549
Family 28-residue LRR 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226437632|ref|NP_001004339.2|
Sequence length 759
Comment protein zyg-11 homolog A [Homo sapiens]
Sequence
MVHFLHPGHTPRNIVPPDAQKDALGCCVVQEEASPYTLVNICLNVLIANLEKLCSERPDG
TLCLPEHWSFPQEVAERFLRVMTWQGKLTDRTASIFRGNQMKLKLVNIQKAKISTAAFIK
AFCRHKLIELNATAVHADLPVPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQL
TGLRILSVFNVCFHTEDLANVSQLPRLESLDISNTLVTDISALLTCKDRLKSLTMHYLKC
LAMTKSQILAVIRELKCLLHLDISDHRQLKSDLAFHLLQQKDILPNVVSLDISGGNCITD
EAVELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEALSRYRNRSCFV
KEALHRLFTETFSMEVTMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGLAKGMPV
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHEN
PKMQTMAVSVTSILALQLSPEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKAL
WNLTDGSPAACKHFIENQGLQIFIQVLETFSESAIQSKVLGLLNNIAEVRELSSKLVTED
VLKHINSLLCSREMEVSYFAAGIIAHLTSDRQLWISRDFQRRTLLQDLHATIQNWPSSSC
KMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYHVCSKNPSKYCKMLVEEEGLQLLCD
IQEHSEATPKAQQIAASILDDFRMHFMNYQRPTLCQMPF
Download sequence
Identical sequences Q6WRX3
NP_001004339.2.87134 NP_001004339.2.92137 gi|226437632|ref|NP_001004339.2| ENSP00000360583 ENSP00000360583 9606.ENSP00000360583 ENSP00000360587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]