SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|226491350|ref|NP_776245.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226491350|ref|NP_776245.2|
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily EF-hand 9.23e-45
Family p25-alpha 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|226491350|ref|NP_776245.2|
Sequence length 170
Comment tubulin polymerization-promoting protein family member 2 [Homo sapiens]
Sequence
MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAK
NARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRL
TDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK
Download sequence
Identical sequences H2Q7X6 P59282
ENSP00000317595 gi|226491350|ref|NP_776245.2| ENSP00000317595 ENSP00000435356 ENSP00000317595 ENSP00000435356 NP_776245.2.87134 NP_776245.2.92137 XP_003804784.1.60992 XP_005267381.1.92137 XP_016876455.1.92137 XP_528697.2.37143 9598.ENSPTRP00000010371 9606.ENSP00000317595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]